Recovery ⏱ Half-life: Variable depending on tissue context. Subject to proteolytic degradation but maintains activity in wound environments.

LL-37

LL-37 (Cathelicidin)

Buy from $44.99 →
Half-Life
Variable depending on tissue context. Subject to proteolytic degradation but maintains activity in wound environments.
Mol. Weight
4493.33 g/mol

What is LL-37?

LL-37 is the sole member of the cathelicidin family of host defense peptides in humans. It serves as a critical first-line defense component of the innate immune system, with activity spanning antimicrobial defense, immune regulation, and tissue repair.

Research Applications

Antimicrobial defense research, wound healing, biofilm disruption, innate immunity studies, and vitamin D-immune axis research.

Dosage Information (Research Use)

Research protocols vary widely by application. Topical, subcutaneous, and in vitro concentrations documented in literature. Research use only.

Reconstitution & Handling

Standard BAC water reconstitution. Store carefully — larger peptide with potential for aggregation.

Half-Life & Pharmacokinetics

Variable depending on tissue context. Subject to proteolytic degradation but maintains activity in wound environments.

Reported Observations in Literature

As an endogenous peptide, generally well-tolerated at physiological concentrations. High concentrations can be cytotoxic to host cells in vitro. Research dosing focuses on staying within physiological ranges.

Key Research References

  • Vandamme D, et al. “A comprehensive summary of LL-37, the factotum human cathelicidin peptide.” Cell Immunol. 2012

How LL-37 Works

LL-37 is the only human cathelicidin antimicrobial peptide. It is cleaved from the precursor protein hCAP18 and has direct antimicrobial activity against bacteria, viruses, and fungi through membrane disruption. Beyond direct antimicrobial action, LL-37 modulates immune responses by recruiting immune cells, promoting angiogenesis, enhancing wound healing, and regulating inflammatory cytokine production.

Research Findings

Research interest in LL-37 spans infectious disease, wound healing, cancer biology (complex dual role), and inflammatory disorders. Vitamin D is the primary regulator of LL-37 expression in human tissues — the vitamin D-cathelicidin axis is a major area of innate immunity research.

Dosage & Administration

Research protocols vary widely by application. Topical, subcutaneous, and in vitro concentrations documented in literature. Research use only.

Safety & Side Effects

As an endogenous peptide, generally well-tolerated at physiological concentrations. High concentrations can be cytotoxic to host cells in vitro. Research dosing focuses on staying within physiological ranges.

Important: All safety information is derived from published research, primarily animal studies. No controlled human clinical trial data exists unless explicitly noted. This compound is sold for research purposes only.

Quick Facts

Sequence [LL-37, 37 aa]
Molecular Weight 4493.33 g/mol
Half-Life Variable depending on tissue context. Subject to proteolytic degradation but maintains activity in wound environments.
Available Sizes 5mg
Storage Lyophilized: -20°C. Reconstituted: 2-8°C.

Key Research References

  • Vandamme D, et al. "A comprehensive summary of LL-37, the factotum human cathelicidin peptide." Cell Immunol. 2012

Get LL-37 from SourcePeptides

Third-party tested • Research-grade purity • Fast US shipping

Shop Now →

Related Peptides

View all →
Recovery
Vascular-targeting tripeptide bioregulator researched for endothelial function and microcirculation support.
Recovery
Thymic peptide with potent immunomodulatory properties, approved in multiple countries for viral hepatitis and as an immune adjuvant.
Recovery
Single-chain relaxin peptide analog researched for anti-fibrotic effects and tissue remodeling without cardiovascular side effects.